(data stored in ACNUC7421 zone)

EMBL: AP009493.PE539

AP009493.PE539       Location/Qualifiers
FT   CDS             complement(623910..624815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_539"
FT                   /product="putative ABC-type Fe3+-siderophore transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_539"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17368"
FT                   /db_xref="GOA:B1VRF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF0"
FT                   /protein_id="BAG17368.1"
FT                   /translation="MPEGLTGPVESSPVEEAGAEAEPGGAPGPEVVRAEGLTFGYPGRP
FT                   VLRGVDLSVRAGELVALIGLNGCGKSTLLKLAAGLLTPSGGRVLLEGDDVARLPRRAAA
FT                   RRVALLHQSAPAVPGLTVRQLVRQGRYAARGPLGMLREGDDEVTSRALADVGVTAWADR
FT                   PVDALSGGERQRVRLAMALAQDARLLFLDEPTTYLDLRHQLEVLRTVVRLRAERRLTVV
FT                   MVLHDLNHAARFADRIVALREGRVAADGPPAEVVTRRLLAEVLGVEGRVGIDSEGGWPV
FT                   CYPDHPLEPLQLLRNENHIH"
     MPEGLTGPVE SSPVEEAGAE AEPGGAPGPE VVRAEGLTFG YPGRPVLRGV DLSVRAGELV        60
     ALIGLNGCGK STLLKLAAGL LTPSGGRVLL EGDDVARLPR RAAARRVALL HQSAPAVPGL       120
     TVRQLVRQGR YAARGPLGML REGDDEVTSR ALADVGVTAW ADRPVDALSG GERQRVRLAM       180
     ALAQDARLLF LDEPTTYLDL RHQLEVLRTV VRLRAERRLT VVMVLHDLNH AARFADRIVA       240
     LREGRVAADG PPAEVVTRRL LAEVLGVEGR VGIDSEGGWP VCYPDHPLEP LQLLRNENHI       300
     H                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page