(data stored in ACNUC7421 zone)

EMBL: AP009493.PE541

AP009493.PE541       Location/Qualifiers
FT   CDS             complement(625956..627017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_541"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_541"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17370"
FT                   /db_xref="GOA:B1VRF2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF2"
FT                   /protein_id="BAG17370.1"
FT                   /translation="MRRPPVVPLCLGAVALAGAVCALSLGTPYVPPAALPAALGSDGLA
FT                   GLVVTELRLPRMVLALIAGACLGAAGLVLQEALRNPLAVPEMLGVSSGAALGVAAPLVL
FT                   ALAVPLGLQPFLALAGAALGGLLTLVAAGFGRSPSAVLLTGAAVAAALQAALLVLMVMA
FT                   DQLDLQLIYRYLLGSLSARTWDDVTGLLPWLAAAVPALVLCVPVLGVLRLGDDDARALG
FT                   VRVERARVAALGIAVVLIAPVVAVCGPVAWVGFLAPHLARRLRPDGGAAGWLVRSAGCG
FT                   AIVVLCADQPARLALAPVETPVGAWTALVGVPVGVLLLKRGRRPARVRRPLPPSLPQAP
FT                   TALAAPVLRKAER"
     MRRPPVVPLC LGAVALAGAV CALSLGTPYV PPAALPAALG SDGLAGLVVT ELRLPRMVLA        60
     LIAGACLGAA GLVLQEALRN PLAVPEMLGV SSGAALGVAA PLVLALAVPL GLQPFLALAG       120
     AALGGLLTLV AAGFGRSPSA VLLTGAAVAA ALQAALLVLM VMADQLDLQL IYRYLLGSLS       180
     ARTWDDVTGL LPWLAAAVPA LVLCVPVLGV LRLGDDDARA LGVRVERARV AALGIAVVLI       240
     APVVAVCGPV AWVGFLAPHL ARRLRPDGGA AGWLVRSAGC GAIVVLCADQ PARLALAPVE       300
     TPVGAWTALV GVPVGVLLLK RGRRPARVRR PLPPSLPQAP TALAAPVLRK AER              353
//

If you have problems or comments...

PBIL Back to PBIL home page