(data stored in ACNUC7421 zone)

EMBL: AP009493.PE542

AP009493.PE542       Location/Qualifiers
FT   CDS             complement(627014..627853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_542"
FT                   /product="putative ABC-type Fe3+-siderophore transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_542"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17371"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF3"
FT                   /protein_id="BAG17371.1"
FT                   /translation="MRPIEAATRITDAEGVTVSLPKPPERIVCLVALCDDMLVELGMTP
FT                   TATNSRVLAHPKFLGEEKAAGIPVVPGGFLSPEVEAVLAHRPDLVIGLEDTHGKLAPAL
FT                   KGATTFWPVQPGSWQDSVGYLRNLAALTGRTEQGERAERGFRTRLARAERSASDRTALI
FT                   VYGSDENFGVATPETDVAAGLFPKISHYPWKSRGVEGSYSLEEILARDVDVLFVETLSF
FT                   GAPDGRLSDKLAQNPLWSRIPAVKNGKVIEVDSEVWAKGRGTRSLGVVLDEATAALR"
     MRPIEAATRI TDAEGVTVSL PKPPERIVCL VALCDDMLVE LGMTPTATNS RVLAHPKFLG        60
     EEKAAGIPVV PGGFLSPEVE AVLAHRPDLV IGLEDTHGKL APALKGATTF WPVQPGSWQD       120
     SVGYLRNLAA LTGRTEQGER AERGFRTRLA RAERSASDRT ALIVYGSDEN FGVATPETDV       180
     AAGLFPKISH YPWKSRGVEG SYSLEEILAR DVDVLFVETL SFGAPDGRLS DKLAQNPLWS       240
     RIPAVKNGKV IEVDSEVWAK GRGTRSLGVV LDEATAALR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page