(data stored in ACNUC7421 zone)

EMBL: AP009493.PE543

AP009493.PE543       Location/Qualifiers
FT   CDS             628200..629480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_543"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17372"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF4"
FT                   /protein_id="BAG17372.1"
FT                   /translation="MPQSPHPSPHAPPRLLVSDHVAGRISLLDLPDGTERAELRHRHLA
FT                   EHAGFLALPDGLTACVDDRAGELLVLDPYGPGAGHPFVRRRIPVAVPAEHLAADPRGRH
FT                   LAVTTGLGRNEEAWTGLLTAVDLDAPDGAVAVRVRGRTGEPGVTVLGGGPSPLVVLRHR
FT                   EPGELLAHRHRDLMRSAPACPPAAPVGRIALPDDDGHGDAHDPLTRRVFAAAGSGVHRA
FT                   RREGDGLVGETPLPWSADGRSGGRGHYLRLDPVRRMLWSCVRGGPGDPGQWPTWSNDAW
FT                   WHQLDTGVTGRLDLGPGLVFRLAVTARHIAYTRVHPDGDELVLLTAPPVAGSRPEIAAR
FT                   LPLPAMSGAPRPGGTPWDGVQRRAVAASPGGGLVAVSRGGHGEVHVFDADRADLLTTLT
FT                   VPTPLDDGGHLALLTPGDGAEADPVGR"
     MPQSPHPSPH APPRLLVSDH VAGRISLLDL PDGTERAELR HRHLAEHAGF LALPDGLTAC        60
     VDDRAGELLV LDPYGPGAGH PFVRRRIPVA VPAEHLAADP RGRHLAVTTG LGRNEEAWTG       120
     LLTAVDLDAP DGAVAVRVRG RTGEPGVTVL GGGPSPLVVL RHREPGELLA HRHRDLMRSA       180
     PACPPAAPVG RIALPDDDGH GDAHDPLTRR VFAAAGSGVH RARREGDGLV GETPLPWSAD       240
     GRSGGRGHYL RLDPVRRMLW SCVRGGPGDP GQWPTWSNDA WWHQLDTGVT GRLDLGPGLV       300
     FRLAVTARHI AYTRVHPDGD ELVLLTAPPV AGSRPEIAAR LPLPAMSGAP RPGGTPWDGV       360
     QRRAVAASPG GGLVAVSRGG HGEVHVFDAD RADLLTTLTV PTPLDDGGHL ALLTPGDGAE       420
     ADPVGR                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page