(data stored in ACNUC7421 zone)

EMBL: AP009493.PE544

AP009493.PE544       Location/Qualifiers
FT   CDS             complement(629544..629849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_544"
FT                   /product="putative 30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_544"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17373"
FT                   /db_xref="GOA:B1VRF5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VRF5"
FT                   /protein_id="BAG17373.1"
FT                   /translation="MAKKSKIARNDRRRETVERYAARRAELKEVIRRPGTPEPERNRAV
FT                   EELRRQPRDASATRVRNRDSVDGRPRGYLRRFGLSRVRMREQAHAGFLPGVTTSSW"
     MAKKSKIARN DRRRETVERY AARRAELKEV IRRPGTPEPE RNRAVEELRR QPRDASATRV        60
     RNRDSVDGRP RGYLRRFGLS RVRMREQAHA GFLPGVTTSS W                           101
//

If you have problems or comments...

PBIL Back to PBIL home page