(data stored in ACNUC7421 zone)

EMBL: AP009493.PE547

AP009493.PE547       Location/Qualifiers
FT   CDS             630380..630634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_547"
FT                   /product="putative 50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_547"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17376"
FT                   /db_xref="GOA:B1VRF8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VRF8"
FT                   /protein_id="BAG17376.1"
FT                   /translation="MKPGIHPSYGPVVFRDKAADFAFLTRSTMTSDRTVAWEDGNTYPV
FT                   VDVEISSASHPFYTGTARVLDTAGRVERFERRYGRGGAR"
     MKPGIHPSYG PVVFRDKAAD FAFLTRSTMT SDRTVAWEDG NTYPVVDVEI SSASHPFYTG        60
     TARVLDTAGR VERFERRYGR GGAR                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page