(data stored in ACNUC7421 zone)

EMBL: AP009493.PE548

AP009493.PE548       Location/Qualifiers
FT   CDS             630631..631785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_548"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17377"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF9"
FT                   /protein_id="BAG17377.1"
FT                   /translation="MSGHRGILPVVIVCGLHSEARREVVEGLLRDVPHSVALHHDLSTA
FT                   TGGTVGRSLRDHGGELASGEAPLVNACACCALREDLVPELERLAGDGRTRLAVLELWDS
FT                   VEPKSMAEVIAAHTTAAEVTNVFAAVDPTLVLPCLSNGDDLAEAGLAAAPADRRTIGDT
FT                   WARQVEYAPVLAVVASPAADDEDRALIRQLNPTARQADSGSAELARLAFAGFDVEAADA
FT                   GQHPACALLPQEADEAGVGTLVWRRHRPFHPERLLDALEDLSCAAARSRGRFWLADRPD
FT                   TLLSWDAAGGALCVENTGPWLASLPDAAWSMVPPYRRAAAALDWHPEHGDRCQHLVFVS
FT                   PGLDREGLTGLLDSCLLTDEEYGGGRETWKRLPAAFDALLDPVH"
     MSGHRGILPV VIVCGLHSEA RREVVEGLLR DVPHSVALHH DLSTATGGTV GRSLRDHGGE        60
     LASGEAPLVN ACACCALRED LVPELERLAG DGRTRLAVLE LWDSVEPKSM AEVIAAHTTA       120
     AEVTNVFAAV DPTLVLPCLS NGDDLAEAGL AAAPADRRTI GDTWARQVEY APVLAVVASP       180
     AADDEDRALI RQLNPTARQA DSGSAELARL AFAGFDVEAA DAGQHPACAL LPQEADEAGV       240
     GTLVWRRHRP FHPERLLDAL EDLSCAAARS RGRFWLADRP DTLLSWDAAG GALCVENTGP       300
     WLASLPDAAW SMVPPYRRAA AALDWHPEHG DRCQHLVFVS PGLDREGLTG LLDSCLLTDE       360
     EYGGGRETWK RLPAAFDALL DPVH                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page