(data stored in ACNUC7421 zone)

EMBL: AP009493.PE552

AP009493.PE552       Location/Qualifiers
FT   CDS             635109..635909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_552"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_552"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17381"
FT                   /db_xref="GOA:B1VRG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG3"
FT                   /protein_id="BAG17381.1"
FT                   /translation="MTIAYDRTDVVHGADLRLPRGRVTALIGPNGSGKSTLLRAVARLH
FT                   KARTGRVTVAPQGEGSEPVDALALSRSDFARRVTLLAQSRNAPAGLSVRDVVGFGRHPY
FT                   RARLRGTDPDGARMVEHALTVTNLTEFADRGVESLSGGQLQRVWFACCLAQDTDVLLLD
FT                   EPTTYLDLRYQVEILDLVRDLADTHGVTVGVVLHDLDQAAAVADQVVLLSSGRIVAAGT
FT                   PAEVYAPERLSDAYGIRIDVEPDSSTGIPRTRAVGRHHLRSERP"
     MTIAYDRTDV VHGADLRLPR GRVTALIGPN GSGKSTLLRA VARLHKARTG RVTVAPQGEG        60
     SEPVDALALS RSDFARRVTL LAQSRNAPAG LSVRDVVGFG RHPYRARLRG TDPDGARMVE       120
     HALTVTNLTE FADRGVESLS GGQLQRVWFA CCLAQDTDVL LLDEPTTYLD LRYQVEILDL       180
     VRDLADTHGV TVGVVLHDLD QAAAVADQVV LLSSGRIVAA GTPAEVYAPE RLSDAYGIRI       240
     DVEPDSSTGI PRTRAVGRHH LRSERP                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page