(data stored in ACNUC7421 zone)

EMBL: AP009493.PE553

AP009493.PE553       Location/Qualifiers
FT   CDS             635918..636892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_553"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_553"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17382"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG4"
FT                   /protein_id="BAG17382.1"
FT                   /translation="MKNQHLTWPVLAAAAALALTACGTTEAPKKESAKDSAVTITDARG
FT                   KKITLDGPAERVVGTEWNVVESLVTLGVQPVGVADVKGYTAYNTAAPLAKGIKDIGTRG
FT                   EPSVATVASLKPDLILATTDLSDSAIAQLSKAAPVAVVRSADASRQIDQMVDTVELIGK
FT                   ATGNEDKAESEVDSFRKAVADGKKKLADAGLDGEKVAFADGWQEGNQVSVRPYVKGSLL
FT                   SDVNTELGLVDPWKLKGDAAYGLAATDVEGLTKIGDARFAYIANDSDGGDPFADGLKDN
FT                   AVWKSLPFVKNDEVHRLPDGIWMFGGTASMREYIDALVGALTA"
     MKNQHLTWPV LAAAAALALT ACGTTEAPKK ESAKDSAVTI TDARGKKITL DGPAERVVGT        60
     EWNVVESLVT LGVQPVGVAD VKGYTAYNTA APLAKGIKDI GTRGEPSVAT VASLKPDLIL       120
     ATTDLSDSAI AQLSKAAPVA VVRSADASRQ IDQMVDTVEL IGKATGNEDK AESEVDSFRK       180
     AVADGKKKLA DAGLDGEKVA FADGWQEGNQ VSVRPYVKGS LLSDVNTELG LVDPWKLKGD       240
     AAYGLAATDV EGLTKIGDAR FAYIANDSDG GDPFADGLKD NAVWKSLPFV KNDEVHRLPD       300
     GIWMFGGTAS MREYIDALVG ALTA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page