(data stored in ACNUC7421 zone)

EMBL: AP009493.PE554

AP009493.PE554       Location/Qualifiers
FT   CDS             636895..639042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_554"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_554"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17383"
FT                   /db_xref="GOA:B1VRG5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG5"
FT                   /protein_id="BAG17383.1"
FT                   /translation="MSTRTTTAPPAPVKTGAGAAGPAGAEPPVAAGPPARRGRMLLLAI
FT                   TGIVALAALAIVHVGQGTAAVDLHTLWQLATGAASDRTADEQTAAVVLDSRLPRLAAGL
FT                   LVGCALGAAGAALQSVSRNMLASPDTLAVNAGAYLAVVAVAAFGITLPALPAGATAFLG
FT                   GLLAAGVVLGLSRAGAGPIRLVLAGSALTLALSGLSGMLLLLRSQQTTGLFAWGNGSLA
FT                   QIGMQSIDRLTPVALVAFAGLMLMGRRLDILALGDDGAAVVGVSPRLTRSIAVILAVLL
FT                   AAVSVAVAGPVGFVGLCAPAVVRLLSTWIPGLVRHHAFIPASALAGVLVVLGADVLLRA
FT                   VFGAQAGAEVPTGIVTTCFGALVLIVLAYRSRDMGTDSGSTAFARLRSRRAFVLTLVAT
FT                   SVGLLGAVVAATLFGDATLLLGDVGNWLTGRAGQFVGYVLDTRVPRVAAALLAGAALAV
FT                   AGAVVQAVSRNPLAEPGVLGVVSGAGVGAVAVLTVVPLASFWLIGGSALAGATAAAALV
FT                   FGLAARRGLEQNRLVLIGIGVQAGAGAFVSLLIVLTDPYNETKALAWLGGSTYGRTFPE
FT                   LIPVLVGLVVALPALALMRRELDLIGLDDETPALLGVRIGATRLALLSLAVLLTAGAVA
FT                   AVGVIGFVGLVAPHAARALVGRRHTRVIPVSALLGALLVVVSDLVGRAIIAPAQIPVGL
FT                   LTAVIGAPYFIWLLWRSRREG"
     MSTRTTTAPP APVKTGAGAA GPAGAEPPVA AGPPARRGRM LLLAITGIVA LAALAIVHVG        60
     QGTAAVDLHT LWQLATGAAS DRTADEQTAA VVLDSRLPRL AAGLLVGCAL GAAGAALQSV       120
     SRNMLASPDT LAVNAGAYLA VVAVAAFGIT LPALPAGATA FLGGLLAAGV VLGLSRAGAG       180
     PIRLVLAGSA LTLALSGLSG MLLLLRSQQT TGLFAWGNGS LAQIGMQSID RLTPVALVAF       240
     AGLMLMGRRL DILALGDDGA AVVGVSPRLT RSIAVILAVL LAAVSVAVAG PVGFVGLCAP       300
     AVVRLLSTWI PGLVRHHAFI PASALAGVLV VLGADVLLRA VFGAQAGAEV PTGIVTTCFG       360
     ALVLIVLAYR SRDMGTDSGS TAFARLRSRR AFVLTLVATS VGLLGAVVAA TLFGDATLLL       420
     GDVGNWLTGR AGQFVGYVLD TRVPRVAAAL LAGAALAVAG AVVQAVSRNP LAEPGVLGVV       480
     SGAGVGAVAV LTVVPLASFW LIGGSALAGA TAAAALVFGL AARRGLEQNR LVLIGIGVQA       540
     GAGAFVSLLI VLTDPYNETK ALAWLGGSTY GRTFPELIPV LVGLVVALPA LALMRRELDL       600
     IGLDDETPAL LGVRIGATRL ALLSLAVLLT AGAVAAVGVI GFVGLVAPHA ARALVGRRHT       660
     RVIPVSALLG ALLVVVSDLV GRAIIAPAQI PVGLLTAVIG APYFIWLLWR SRREG            715
//

If you have problems or comments...

PBIL Back to PBIL home page