(data stored in ACNUC7421 zone)

EMBL: AP009493.PE555

AP009493.PE555       Location/Qualifiers
FT   CDS             complement(639193..639858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_555"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17384"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG6"
FT                   /protein_id="BAG17384.1"
FT                   /translation="MDTATRLRQTVISWAAGDADTPAPAQAGAARALAAELSLRTVVLV
FT                   EGVSDRAAVEALAERRGRTLSAEGVVVVPLGGATSITRYLRLLGPHGLDARPAGLCDAA
FT                   EEHFFRQGLERTGFGAARTPGDLAALGFFTCRADLEDELIRALGADGVQQVVDDQGDLR
FT                   TFRIFQRQPAQRERPVEAQLRRFMGTIGGRKEHYARALADALDLARLPEPLDGLLSHI"
     MDTATRLRQT VISWAAGDAD TPAPAQAGAA RALAAELSLR TVVLVEGVSD RAAVEALAER        60
     RGRTLSAEGV VVVPLGGATS ITRYLRLLGP HGLDARPAGL CDAAEEHFFR QGLERTGFGA       120
     ARTPGDLAAL GFFTCRADLE DELIRALGAD GVQQVVDDQG DLRTFRIFQR QPAQRERPVE       180
     AQLRRFMGTI GGRKEHYARA LADALDLARL PEPLDGLLSH I                           221
//

If you have problems or comments...

PBIL Back to PBIL home page