(data stored in ACNUC7421 zone)

EMBL: AP009493.PE557

AP009493.PE557       Location/Qualifiers
FT   CDS             complement(641140..641589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_557"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17386"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG8"
FT                   /protein_id="BAG17386.1"
FT                   /translation="MEDSGAGSVPPPNGADVQDPAAQARLVALVAEWSAAIVSNDVSRI
FT                   RAFMAEEWVIVSESGITDRDAFLGFVASGDLTHSAMRSISPPRVRVHRDTATVTARMTN
FT                   TAHYAGRRFDADEWVTDVFVRREGLWLCVLTHITSAAPTDPAPAV"
     MEDSGAGSVP PPNGADVQDP AAQARLVALV AEWSAAIVSN DVSRIRAFMA EEWVIVSESG        60
     ITDRDAFLGF VASGDLTHSA MRSISPPRVR VHRDTATVTA RMTNTAHYAG RRFDADEWVT       120
     DVFVRREGLW LCVLTHITSA APTDPAPAV                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page