(data stored in ACNUC7421 zone)

EMBL: AP009493.PE558

AP009493.PE558       Location/Qualifiers
FT   CDS             complement(641702..642256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_558"
FT                   /product="conserved hypothetical protein containing a
FT                   MaoC-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_558"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17387"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRG9"
FT                   /protein_id="BAG17387.1"
FT                   /translation="MTLRHVKDNEYVEEHGGDYEDFEPGMVIRHWPGRTLSEADNTWLT
FT                   LLTMNQHPLHFDQHYGAGAEYGKVLVNSGITLCLVGGMTVQALSARAVANLGWDRVRLK
FT                   TPVFVGDTLYATSRILDKRLSRSRPGQGIITVETTGTKSTGETVIVFERSFMVRCRELP
FT                   APPTERTRKEATTAVEGAPPA"
     MTLRHVKDNE YVEEHGGDYE DFEPGMVIRH WPGRTLSEAD NTWLTLLTMN QHPLHFDQHY        60
     GAGAEYGKVL VNSGITLCLV GGMTVQALSA RAVANLGWDR VRLKTPVFVG DTLYATSRIL       120
     DKRLSRSRPG QGIITVETTG TKSTGETVIV FERSFMVRCR ELPAPPTERT RKEATTAVEG       180
     APPA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page