(data stored in ACNUC7421 zone)

EMBL: AP009493.PE562

AP009493.PE562       Location/Qualifiers
FT   CDS             complement(645575..646828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_562"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17391"
FT                   /db_xref="GOA:B1VRH3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRH3"
FT                   /protein_id="BAG17391.1"
FT                   /translation="MSERRTITPTHRYRNNDKLIGIGNAFWNRSYENGVAGIVGDLEDG
FT                   VFHMPDGHEFVNFTVCSYLDLDTHPAVIDGAVASLRRFGVLDHCIPRTRVQTPVLLELE
FT                   ESLGELFGAMVISALSTAAASTGLLPMIASGHLGNGTRPLMVFDKNAHVSLAHAKPSCA
FT                   DESEVVTCGHHDLDFIEDMCLTYERVCYVVDGSDSLGGYAPVQELAELQDKYNLLVFYD
FT                   DSHSLSAYGERGIGYVRTHSPVLDERTITVATLTKGFGAGGTAILLDGYPEQTRRLVER
FT                   FAGPLGYSQKMNAAAVGAALASAEIHRTEELTRLQGRLRSNIALFDSLVQTEQAEGTYP
FT                   IRVVPMSDDTVVDAAKQVFAAGFYTSPVFFPIVARGTAGLRVMLRAGQSADQIKRLCTA
FT                   LVEAGARPAGPLPGAVHR"
     MSERRTITPT HRYRNNDKLI GIGNAFWNRS YENGVAGIVG DLEDGVFHMP DGHEFVNFTV        60
     CSYLDLDTHP AVIDGAVASL RRFGVLDHCI PRTRVQTPVL LELEESLGEL FGAMVISALS       120
     TAAASTGLLP MIASGHLGNG TRPLMVFDKN AHVSLAHAKP SCADESEVVT CGHHDLDFIE       180
     DMCLTYERVC YVVDGSDSLG GYAPVQELAE LQDKYNLLVF YDDSHSLSAY GERGIGYVRT       240
     HSPVLDERTI TVATLTKGFG AGGTAILLDG YPEQTRRLVE RFAGPLGYSQ KMNAAAVGAA       300
     LASAEIHRTE ELTRLQGRLR SNIALFDSLV QTEQAEGTYP IRVVPMSDDT VVDAAKQVFA       360
     AGFYTSPVFF PIVARGTAGL RVMLRAGQSA DQIKRLCTAL VEAGARPAGP LPGAVHR          417
//

If you have problems or comments...

PBIL Back to PBIL home page