(data stored in ACNUC7421 zone)

EMBL: AP009493.PE563

AP009493.PE563       Location/Qualifiers
FT   CDS             complement(646825..647727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_563"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17392"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRH4"
FT                   /protein_id="BAG17392.1"
FT                   /translation="MRPGDERRTSDMAVPEAVPGPNGTAGVEITRMTFDEFLAVGPRGL
FT                   YKADRPVVIKLPADVQGLGRDEVAERLAGMTVTLFTEPGDKNHPGRWETRDIKLREFFA
FT                   DERHLTATDTWHRVVSNIRSSPADVNAVIGFDAEEFFGYGDSLYAANLWISHRGVFTKN
FT                   HFDEFENFNIALEGRKRFIIAPPGVRAYYPRSVLRGFGDKSNVVDLDDADLSRYPRLAA
FT                   KLAQRRDFVLEPGHMLYLPLGWWHQAESLDELNINVNFWLKSKKILHRPHVLGVALYTY
FT                   AYRRLKGVYSYKPTEGNSR"
     MRPGDERRTS DMAVPEAVPG PNGTAGVEIT RMTFDEFLAV GPRGLYKADR PVVIKLPADV        60
     QGLGRDEVAE RLAGMTVTLF TEPGDKNHPG RWETRDIKLR EFFADERHLT ATDTWHRVVS       120
     NIRSSPADVN AVIGFDAEEF FGYGDSLYAA NLWISHRGVF TKNHFDEFEN FNIALEGRKR       180
     FIIAPPGVRA YYPRSVLRGF GDKSNVVDLD DADLSRYPRL AAKLAQRRDF VLEPGHMLYL       240
     PLGWWHQAES LDELNINVNF WLKSKKILHR PHVLGVALYT YAYRRLKGVY SYKPTEGNSR       300
//

If you have problems or comments...

PBIL Back to PBIL home page