(data stored in ACNUC7421 zone)

EMBL: AP009493.PE567

AP009493.PE567       Location/Qualifiers
FT   CDS             651869..653260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_567"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17396"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRH8"
FT                   /protein_id="BAG17396.1"
FT                   /translation="MTTTTSPHTPPRSRLGHAYGEQLARNGSAGRPTAAALESATLRLA
FT                   YQDRFLNGPAFLGGSELRTLVGDLHTVYGLLRSLPERGFGGSVTALAAAVGLEPSQAAL
FT                   ITRSARTGSLLPLGRADLYHDGSGFKLLEFNITSALGGFENADINRAMLAYPPLDAFVT
FT                   RHRLRYEDTLGHMVRTMYAECAANIPAGRAPVVAVVDTVENFAVVGPRLRVFAEKLADF
FT                   GVEGIACDLGEITYPNGRPTVAGRTVDVVFRYFLPEDLTDPVAAAQLEPLLTAVERGGL
FT                   GLFSRLDAELYGNKGTLAMLSDEEHRDRYDAAELACLDRILPWTRYVRPRATDPGGSRV
FT                   DLLSHARGHQHELILKPTLLHGGNGIIAGWTVDPAEWESRVASAMDGPFVLQRRVRPTA
FT                   EPFPDGAGGVRELFLNWGLYLGARGTEEDGYAGGFVRGSADPAVGVVSMGSGATVGCVF
FT                   HGGDS"
     MTTTTSPHTP PRSRLGHAYG EQLARNGSAG RPTAAALESA TLRLAYQDRF LNGPAFLGGS        60
     ELRTLVGDLH TVYGLLRSLP ERGFGGSVTA LAAAVGLEPS QAALITRSAR TGSLLPLGRA       120
     DLYHDGSGFK LLEFNITSAL GGFENADINR AMLAYPPLDA FVTRHRLRYE DTLGHMVRTM       180
     YAECAANIPA GRAPVVAVVD TVENFAVVGP RLRVFAEKLA DFGVEGIACD LGEITYPNGR       240
     PTVAGRTVDV VFRYFLPEDL TDPVAAAQLE PLLTAVERGG LGLFSRLDAE LYGNKGTLAM       300
     LSDEEHRDRY DAAELACLDR ILPWTRYVRP RATDPGGSRV DLLSHARGHQ HELILKPTLL       360
     HGGNGIIAGW TVDPAEWESR VASAMDGPFV LQRRVRPTAE PFPDGAGGVR ELFLNWGLYL       420
     GARGTEEDGY AGGFVRGSAD PAVGVVSMGS GATVGCVFHG GDS                         463
//

If you have problems or comments...

PBIL Back to PBIL home page