(data stored in ACNUC7421 zone)

EMBL: AP009493.PE569

AP009493.PE569       Location/Qualifiers
FT   CDS             653858..654250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_569"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17398"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRI0"
FT                   /protein_id="BAG17398.1"
FT                   /translation="MAVQTVYFVFRNKRALFKDVVDTSIAGDVEPVATMDRDWFRAACA
FT                   EPTAAAQLRAHVSGVRGILVRVAPIMPLIAAAAASDPEIAAQWPSGPDPRYTVQHAAAK
FT                   ALTSKPDAWEAWARATLIDHLCTDHA"
     MAVQTVYFVF RNKRALFKDV VDTSIAGDVE PVATMDRDWF RAACAEPTAA AQLRAHVSGV        60
     RGILVRVAPI MPLIAAAAAS DPEIAAQWPS GPDPRYTVQH AAAKALTSKP DAWEAWARAT       120
     LIDHLCTDHA                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page