(data stored in ACNUC7421 zone)

EMBL: AP009493.PE572

AP009493.PE572       Location/Qualifiers
FT   CDS             complement(656997..657815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_572"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17401"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRI3"
FT                   /protein_id="BAG17401.1"
FT                   /translation="MMHLPQWRVLRDGDADLVLTVAFDPGRGNANFSDLARCLGGRRVL
FT                   EAVPRRTTVAALRDEGVDGYVAPWLEAVKEHGKPVKAVLGHCGGDSLARELAIGVRAWG
FT                   LGEPSLMTFDPLVVDGSVLVEEYRVAVGALVAQLTPRDLEPALAAAESHDPASAAGGSD
FT                   LLSLAETLERAYRTAAAAACRNVSVAPAVQQQLCDRFSAYLTYLAAAARARSAHPSAHA
FT                   PIATTVLSATADAGPRTADPCGTITRFAVGPDRLLGDPEVAAHVSRALSG"
     MMHLPQWRVL RDGDADLVLT VAFDPGRGNA NFSDLARCLG GRRVLEAVPR RTTVAALRDE        60
     GVDGYVAPWL EAVKEHGKPV KAVLGHCGGD SLARELAIGV RAWGLGEPSL MTFDPLVVDG       120
     SVLVEEYRVA VGALVAQLTP RDLEPALAAA ESHDPASAAG GSDLLSLAET LERAYRTAAA       180
     AACRNVSVAP AVQQQLCDRF SAYLTYLAAA ARARSAHPSA HAPIATTVLS ATADAGPRTA       240
     DPCGTITRFA VGPDRLLGDP EVAAHVSRAL SG                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page