(data stored in ACNUC7421 zone)

EMBL: AP009493.PE578

AP009493.PE578       Location/Qualifiers
FT   CDS             664739..665674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_578"
FT                   /product="putative SyrP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_578"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17407"
FT                   /db_xref="GOA:B1VRI9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRI9"
FT                   /protein_id="BAG17407.1"
FT                   /translation="MDLPLVIEAQDDENLLHRTARDRAGIRRALRTNGAVLLRGFAVEG
FT                   VDGFEAAVRELSGGAPLPYEERSSPRSTIKGRVYTSTDYPPHEEIFFHNENSYRVSWPM
FT                   SLYFYCVEPPRRRGATPLSDTREVLRALDPAVREEFERRGWKVVRNFGSEFGLSWQEVF
FT                   NSGDRAQVERFCAANDVSVEWRPDGGLRTSSVRDAVHRHPETGEEVWFNHAAIFHLSTL
FT                   SPEIREGMLELFDEEDLPNNSYFGDGAAIPDNVMAHVRDCYRSAATRFDYARDDVLVVD
FT                   NMLTAHGREPFTRPRTIAVAMAEPGPGVRA"
     MDLPLVIEAQ DDENLLHRTA RDRAGIRRAL RTNGAVLLRG FAVEGVDGFE AAVRELSGGA        60
     PLPYEERSSP RSTIKGRVYT STDYPPHEEI FFHNENSYRV SWPMSLYFYC VEPPRRRGAT       120
     PLSDTREVLR ALDPAVREEF ERRGWKVVRN FGSEFGLSWQ EVFNSGDRAQ VERFCAANDV       180
     SVEWRPDGGL RTSSVRDAVH RHPETGEEVW FNHAAIFHLS TLSPEIREGM LELFDEEDLP       240
     NNSYFGDGAA IPDNVMAHVR DCYRSAATRF DYARDDVLVV DNMLTAHGRE PFTRPRTIAV       300
     AMAEPGPGVR A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page