(data stored in ACNUC7421 zone)

EMBL: AP009493.PE588

AP009493.PE588       Location/Qualifiers
FT   CDS             complement(684163..685278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_588"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRJ9"
FT                   /protein_id="BAG17417.1"
FT                   /translation="MSPPIRLSAAIMTHPARRARALALRDSLPELDLQVVEDPDPYGAG
FT                   SCSARTAVLAWGAVTPHATHHLVLQDDAVPVADLREQVLRRVGERPAAAISLYTEWASA
FT                   TSSAVHLAAWLGQPFAEVCDPYTPCIGLVLPAEAARELARTRPEVPQDDVMIAGVLRRL
FT                   GVPAYVTVPNLVQHATEASLTGNTPMGLRLAACYSTAPHSDTAPVVDARVDLLPCFSRS
FT                   YGRPYYLERDPGSVSGWSQRGLLETLRRRDVDVPALQRAAARRSAGLHRAEPDLRPDIV
FT                   VSLWITAWLGGTELRRLLRDHALAPAEVLDRRLGQIALANIGPGIFDQYMPPERLLELS
FT                   PVLEGFAQAAFTEGVTPSVTGHSPDHRSLNG"
     MSPPIRLSAA IMTHPARRAR ALALRDSLPE LDLQVVEDPD PYGAGSCSAR TAVLAWGAVT        60
     PHATHHLVLQ DDAVPVADLR EQVLRRVGER PAAAISLYTE WASATSSAVH LAAWLGQPFA       120
     EVCDPYTPCI GLVLPAEAAR ELARTRPEVP QDDVMIAGVL RRLGVPAYVT VPNLVQHATE       180
     ASLTGNTPMG LRLAACYSTA PHSDTAPVVD ARVDLLPCFS RSYGRPYYLE RDPGSVSGWS       240
     QRGLLETLRR RDVDVPALQR AAARRSAGLH RAEPDLRPDI VVSLWITAWL GGTELRRLLR       300
     DHALAPAEVL DRRLGQIALA NIGPGIFDQY MPPERLLELS PVLEGFAQAA FTEGVTPSVT       360
     GHSPDHRSLN G                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page