(data stored in ACNUC7421 zone)

EMBL: AP009493.PE590

AP009493.PE590       Location/Qualifiers
FT   CDS             complement(687038..687763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17419"
FT                   /db_xref="GOA:B1VRK1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK1"
FT                   /protein_id="BAG17419.1"
FT                   /translation="MINETDLWSLAKRALAPADRPAEHNPPQWPPAQDTSRISRSVPLH
FT                   DVLTARRSVRRFREDPVPDTDLATLLDLATSTDRQMWPHGTAATTPQAWLVSGVAGTSG
FT                   ARLRQYVPRRSPAGAATAVEPLAGEFTDHGDCPEPALLAARYAPAPVTVLICAEITDDT
FT                   GTAADDTGSDYGRALLRASAFGYNAWLSAVAAGLGGSVHGRSSPEVTRIVRRHTGTPAR
FT                   HLFTLVLGHPAESPQEFGP"
     MINETDLWSL AKRALAPADR PAEHNPPQWP PAQDTSRISR SVPLHDVLTA RRSVRRFRED        60
     PVPDTDLATL LDLATSTDRQ MWPHGTAATT PQAWLVSGVA GTSGARLRQY VPRRSPAGAA       120
     TAVEPLAGEF TDHGDCPEPA LLAARYAPAP VTVLICAEIT DDTGTAADDT GSDYGRALLR       180
     ASAFGYNAWL SAVAAGLGGS VHGRSSPEVT RIVRRHTGTP ARHLFTLVLG HPAESPQEFG       240
     P                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page