(data stored in ACNUC7421 zone)

EMBL: AP009493.PE591

AP009493.PE591       Location/Qualifiers
FT   CDS             complement(687760..689412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_591"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17420"
FT                   /db_xref="GOA:B1VRK2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK2"
FT                   /protein_id="BAG17420.1"
FT                   /translation="MAVSAADGQVVFSAGQIRKRIGGGDALRLLLPIASAMDGRRTVGD
FT                   LAEATDLPYEAVAQAVALLVKQGLVLSGEVSSPKPLAAGVVDYLEQTAGSSATFRDASE
FT                   VLERLSRCAVLIVAPPGHTEAVRDDLAMSGVGTVHSASTPAGVGNEVLDSLRAAAGSLV
FT                   VLYGPPRHDDGTDSFTDDCAARDIAVLHYAAHQGQVDLGPLVHPRATLCRRCFTSGYLA
FT                   EFGSEQPAPADTATTTVAAGLVVGEALAYLADVDSMRTSQALVRWTLPDSTAVRYAVSA
FT                   EAGCASCATTSRRSGERATVLEAYEDVVAAQPLADRPQPPVTAGRKKRLTALGKERESF
FT                   PTAPVIPLPPPPVTASAAPTGDEAPAVSEAGPSGTVGTADAAFVADLAAMVAGRRGDGG
FT                   PRRWTASGGELASVELYLMCADTVSGLPAHTLLKYDDVAHRLLVTRRTHGPGLWRSMLD
FT                   ATGITETADVVLVVVGALWRLKLKYSTFGIRLGHLDAGCALAQLHAVATDRGARVTLND
FT                   RWQPTLPTLLELKEDEQVMAVAGLWTPRSARCH"
     MAVSAADGQV VFSAGQIRKR IGGGDALRLL LPIASAMDGR RTVGDLAEAT DLPYEAVAQA        60
     VALLVKQGLV LSGEVSSPKP LAAGVVDYLE QTAGSSATFR DASEVLERLS RCAVLIVAPP       120
     GHTEAVRDDL AMSGVGTVHS ASTPAGVGNE VLDSLRAAAG SLVVLYGPPR HDDGTDSFTD       180
     DCAARDIAVL HYAAHQGQVD LGPLVHPRAT LCRRCFTSGY LAEFGSEQPA PADTATTTVA       240
     AGLVVGEALA YLADVDSMRT SQALVRWTLP DSTAVRYAVS AEAGCASCAT TSRRSGERAT       300
     VLEAYEDVVA AQPLADRPQP PVTAGRKKRL TALGKERESF PTAPVIPLPP PPVTASAAPT       360
     GDEAPAVSEA GPSGTVGTAD AAFVADLAAM VAGRRGDGGP RRWTASGGEL ASVELYLMCA       420
     DTVSGLPAHT LLKYDDVAHR LLVTRRTHGP GLWRSMLDAT GITETADVVL VVVGALWRLK       480
     LKYSTFGIRL GHLDAGCALA QLHAVATDRG ARVTLNDRWQ PTLPTLLELK EDEQVMAVAG       540
     LWTPRSARCH                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page