(data stored in ACNUC7421 zone)

EMBL: AP009493.PE592

AP009493.PE592       Location/Qualifiers
FT   CDS             complement(689453..690049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_592"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17421"
FT                   /db_xref="InterPro:IPR022291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK3"
FT                   /protein_id="BAG17421.1"
FT                   /translation="MLVDADAAVLVLDRPARRLARRFRQVASEAGKPWLLVEFDHPVIR
FT                   VGPYFDPAAGPCLDCFYAREDQHADKPAPLREPAPGHEHEHTHEHNHGHAHAPDCSHTS
FT                   APASAEEGLGVEAAAGVLPHQARIAAGLLSLSLTEQVRGRVVTVDLRTAAVRSDQVIGC
FT                   HGCPHCGDETQRTLMSRQLDHLFRTVGGVTHDEHR"
     MLVDADAAVL VLDRPARRLA RRFRQVASEA GKPWLLVEFD HPVIRVGPYF DPAAGPCLDC        60
     FYAREDQHAD KPAPLREPAP GHEHEHTHEH NHGHAHAPDC SHTSAPASAE EGLGVEAAAG       120
     VLPHQARIAA GLLSLSLTEQ VRGRVVTVDL RTAAVRSDQV IGCHGCPHCG DETQRTLMSR       180
     QLDHLFRTVG GVTHDEHR                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page