(data stored in ACNUC7421 zone)

EMBL: AP009493.PE593

AP009493.PE593       Location/Qualifiers
FT   CDS             complement(690160..691515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_593"
FT                   /product="hypothetical protein of YcaO-like family"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_593"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17422"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK4"
FT                   /protein_id="BAG17422.1"
FT                   /translation="MAPVGGCHPDKEPRCSLPDLNDVNMKHLDPLLSRYGVVGDAFDLS
FT                   PSRYRGLPELSSYGVDLGSGFPGFEARPDDRVVAGGHALGDKDRARLLAIAEGCERYSG
FT                   AQFGTEGVVTAAAHDLDGRVLDWSRIPRLSDAEYAHPRCPLVPFDPAAPIRWVRGVDLR
FT                   DGNPTWLPLSMAAYRSGRRFPAERFVASISTGCAVHTDPASAVFGGLSEVVERDMIAVL
FT                   WLQKLPLPHIPLDVLDERERTLVEWAHDRFLNTVLLDATSDIGVPTVYCMQTAPHDQTL
FT                   RTMVGCGTGLTIQDAAYKALLEVTCFRDSLHVEWEEPVSFADYTDISDGAKYMGKPENA
FT                   PHFAFLTDDHPDRPSFQDRGRYAADATEGLARAVRRFAELDMAVIAVDRTTTELASVGL
FT                   HSATVVIPDLQPMSPVPLAQYHAHPRLYSAPAAMGYRVLPVEELNPCPQPFA"
     MAPVGGCHPD KEPRCSLPDL NDVNMKHLDP LLSRYGVVGD AFDLSPSRYR GLPELSSYGV        60
     DLGSGFPGFE ARPDDRVVAG GHALGDKDRA RLLAIAEGCE RYSGAQFGTE GVVTAAAHDL       120
     DGRVLDWSRI PRLSDAEYAH PRCPLVPFDP AAPIRWVRGV DLRDGNPTWL PLSMAAYRSG       180
     RRFPAERFVA SISTGCAVHT DPASAVFGGL SEVVERDMIA VLWLQKLPLP HIPLDVLDER       240
     ERTLVEWAHD RFLNTVLLDA TSDIGVPTVY CMQTAPHDQT LRTMVGCGTG LTIQDAAYKA       300
     LLEVTCFRDS LHVEWEEPVS FADYTDISDG AKYMGKPENA PHFAFLTDDH PDRPSFQDRG       360
     RYAADATEGL ARAVRRFAEL DMAVIAVDRT TTELASVGLH SATVVIPDLQ PMSPVPLAQY       420
     HAHPRLYSAP AAMGYRVLPV EELNPCPQPF A                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page