(data stored in ACNUC7421 zone)

EMBL: AP009493.PE594

AP009493.PE594       Location/Qualifiers
FT   CDS             complement(692263..692799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_594"
FT                   /product="putative pyridoxamine 5'-phosphate
FT                   oxidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_594"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17423"
FT                   /db_xref="GOA:B1VRK5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRK5"
FT                   /protein_id="BAG17423.1"
FT                   /translation="MPDRDPIAEIGPFSDARADATPWPTALRVLEQARLFWLSTVRPDG
FT                   RPHVTPLLAVWNGGALYFATGDQERKARNLQGNHHCVMTTGTNVLDGLDITIEGLAESV
FT                   SDPTERGTAADAYEDKYGDLLTSPDGTWYGLGDTIRVGDVLLYRIDPAVGFAFGKGAVY
FT                   SQTRYRFHHGSSEQR"
     MPDRDPIAEI GPFSDARADA TPWPTALRVL EQARLFWLST VRPDGRPHVT PLLAVWNGGA        60
     LYFATGDQER KARNLQGNHH CVMTTGTNVL DGLDITIEGL AESVSDPTER GTAADAYEDK       120
     YGDLLTSPDG TWYGLGDTIR VGDVLLYRID PAVGFAFGKG AVYSQTRYRF HHGSSEQR         178
//

If you have problems or comments...

PBIL Back to PBIL home page