(data stored in ACNUC7421 zone)

EMBL: AP009493.PE599

AP009493.PE599       Location/Qualifiers
FT   CDS             697799..698602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_599"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17428"
FT                   /db_xref="GOA:B1VRL0"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL0"
FT                   /protein_id="BAG17428.1"
FT                   /translation="MSDLANVLKDLATAGDETDRMVADLDDAQWALDTPAPGWTVTDQI
FT                   AHLVFVYRLAGTAAADPEAFRAMTEKASGDFDGAVNAALAAYRSGTPQALLDRWRAERA
FT                   ATIEALAAVPPGQTVPWLVNPLPPVVLACAGLMETFAHGQDIADTIGVRRDPAPWLRHV
FT                   AGFAVLTQAFGYEARGLTPPSEPFRFELTSPTGELWEYGPPEAAHRITGPAHDFCLLVT
FT                   RRRHRDDLALTATKGAADHWLDIAQAYRGPAGEGRRPGQFSDTSR"
     MSDLANVLKD LATAGDETDR MVADLDDAQW ALDTPAPGWT VTDQIAHLVF VYRLAGTAAA        60
     DPEAFRAMTE KASGDFDGAV NAALAAYRSG TPQALLDRWR AERAATIEAL AAVPPGQTVP       120
     WLVNPLPPVV LACAGLMETF AHGQDIADTI GVRRDPAPWL RHVAGFAVLT QAFGYEARGL       180
     TPPSEPFRFE LTSPTGELWE YGPPEAAHRI TGPAHDFCLL VTRRRHRDDL ALTATKGAAD       240
     HWLDIAQAYR GPAGEGRRPG QFSDTSR                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page