(data stored in ACNUC7421 zone)

EMBL: AP009493.PE6

AP009493.PE6         Location/Qualifiers
FT   CDS             complement(5816..6055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_6t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_6t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16835"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK4"
FT                   /protein_id="BAG16835.1"
FT                   /translation="MLVPHLRERSPVVTLRFIGTTSEHGNCPTLYEVVETGDIVVQGDQ
FT                   LTNPVDLAQLRDVGEHETFVVIPRELLTRFAPKE"
     MLVPHLRERS PVVTLRFIGT TSEHGNCPTL YEVVETGDIV VQGDQLTNPV DLAQLRDVGE        60
     HETFVVIPRE LLTRFAPKE                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page