(data stored in ACNUC7421 zone)

EMBL: AP009493.PE601

AP009493.PE601       Location/Qualifiers
FT   CDS             complement(700856..701341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_601"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17430"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL2"
FT                   /protein_id="BAG17430.1"
FT                   /translation="MAGVVPWPGAVAAGALELLQTAATGMSDSLEAFADALNAHAERLH
FT                   AQSRPDPAGEPAERDPGVPPFVALSFAERTRLVVILTAPGHPERHLWVSLALFSNMAFD
FT                   TGAHLHTADAIAAGHPGLAALGFAPPSDDGQWRFSEFSYGRPLARLHPDTTPSGSLA"
     MAGVVPWPGA VAAGALELLQ TAATGMSDSL EAFADALNAH AERLHAQSRP DPAGEPAERD        60
     PGVPPFVALS FAERTRLVVI LTAPGHPERH LWVSLALFSN MAFDTGAHLH TADAIAAGHP       120
     GLAALGFAPP SDDGQWRFSE FSYGRPLARL HPDTTPSGSL A                           161
//

If you have problems or comments...

PBIL Back to PBIL home page