(data stored in ACNUC7421 zone)

EMBL: AP009493.PE603

AP009493.PE603       Location/Qualifiers
FT   CDS             complement(703017..703445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_603"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17432"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL4"
FT                   /protein_id="BAG17432.1"
FT                   /translation="MNSTDTTTTTTADEREQGVAGLPERIMAAWAAHDSAAFADIFTEN
FT                   GSMVMPGVHCQGREAIRSFMATAFEGPFRGTQVVGAPVAVNFLSDEAAVLVTEGGVRAP
FT                   GEDTLRPERRVRASWVAVRGKDGVWSLAAYQNSPFDAS"
     MNSTDTTTTT TADEREQGVA GLPERIMAAW AAHDSAAFAD IFTENGSMVM PGVHCQGREA        60
     IRSFMATAFE GPFRGTQVVG APVAVNFLSD EAAVLVTEGG VRAPGEDTLR PERRVRASWV       120
     AVRGKDGVWS LAAYQNSPFD AS                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page