(data stored in ACNUC7421 zone)

EMBL: AP009493.PE61

AP009493.PE61        Location/Qualifiers
FT   CDS             65873..66136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_61t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_61t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16890"
FT                   /db_xref="GOA:B1VLY9"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLY9"
FT                   /protein_id="BAG16890.1"
FT                   /translation="MCARTYEFTDAEGRARRLTDDYTCGERVEILHDPAPDGDTARIGR
FT                   GTTGTLVFAGCVCLLSLVMAAALVAIGLARPHAALDVISPGL"
     MCARTYEFTD AEGRARRLTD DYTCGERVEI LHDPAPDGDT ARIGRGTTGT LVFAGCVCLL        60
     SLVMAAALVA IGLARPHAAL DVISPGL                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page