(data stored in ACNUC7421 zone)

EMBL: AP009493.PE612

AP009493.PE612       Location/Qualifiers
FT   CDS             717867..718904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_612"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17441"
FT                   /db_xref="GOA:B1VRM3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM3"
FT                   /protein_id="BAG17441.1"
FT                   /translation="MRPLVRAVLRGSLRQVRYVDVIAPHRARGLVAQVYRATERDFGVL
FT                   APPVALHSPAAASLAATWLMLREVLLVDGRVSRAVKETVATAVSRANDCPYCVHVHQAV
FT                   LGTLPPDRTVSPVAEWAAAAGRRHPGDPAGSAPPPFTEAQLPELCGVVVTFHYINRMVS
FT                   VFLADSPMPALTPAPLRAPIMRTTALAMRPVTPGPMAPGASLDLLPAAPLPPGLEWALG
FT                   SPPVAEAFGRAFAAVDQGARWVPKPVRERLRSRLDRWDGSAPGLGRAWLDEAVSALPAE
FT                   DVPAARLVLLTAFAPHQTLPEDVAAFRVRFPTDRELVELTSWAALTTAVRIGGRLLPSR
FT                   PARPA"
     MRPLVRAVLR GSLRQVRYVD VIAPHRARGL VAQVYRATER DFGVLAPPVA LHSPAAASLA        60
     ATWLMLREVL LVDGRVSRAV KETVATAVSR ANDCPYCVHV HQAVLGTLPP DRTVSPVAEW       120
     AAAAGRRHPG DPAGSAPPPF TEAQLPELCG VVVTFHYINR MVSVFLADSP MPALTPAPLR       180
     APIMRTTALA MRPVTPGPMA PGASLDLLPA APLPPGLEWA LGSPPVAEAF GRAFAAVDQG       240
     ARWVPKPVRE RLRSRLDRWD GSAPGLGRAW LDEAVSALPA EDVPAARLVL LTAFAPHQTL       300
     PEDVAAFRVR FPTDRELVEL TSWAALTTAV RIGGRLLPSR PARPA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page