(data stored in ACNUC7421 zone)

EMBL: AP009493.PE616

AP009493.PE616       Location/Qualifiers
FT   CDS             721404..721880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_616"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17445"
FT                   /db_xref="GOA:B1VRM7"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM7"
FT                   /protein_id="BAG17445.1"
FT                   /translation="MATRGRRPSGFVSLLLLLAGVLLFWLTVPNLGNAARAATADGPRG
FT                   TFTAARLVCVGHSGHTTCEWSGTFRSDDGAVETGGVKLYGSGRGTFEAGQTAPAVDVGN
FT                   AGRVYDPSGSRAWIVTVLLVVLAYVLLVTAARRHLAPPPAPSGGRSPATAPPRR"
     MATRGRRPSG FVSLLLLLAG VLLFWLTVPN LGNAARAATA DGPRGTFTAA RLVCVGHSGH        60
     TTCEWSGTFR SDDGAVETGG VKLYGSGRGT FEAGQTAPAV DVGNAGRVYD PSGSRAWIVT       120
     VLLVVLAYVL LVTAARRHLA PPPAPSGGRS PATAPPRR                               158
//

If you have problems or comments...

PBIL Back to PBIL home page