(data stored in ACNUC7421 zone)

EMBL: AP009493.PE617

AP009493.PE617       Location/Qualifiers
FT   CDS             complement(721936..723279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_617"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17446"
FT                   /db_xref="GOA:B1VRM8"
FT                   /db_xref="InterPro:IPR010610"
FT                   /db_xref="InterPro:IPR030953"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM8"
FT                   /protein_id="BAG17446.1"
FT                   /translation="MRILFVAAPFRSHLYVQTPLAWALRTAGHDVRIAASPDLADDIAH
FT                   SGLTGVTIGPLVSLSAHMAASAPAPDDAPAAPAPPESATAAGPVPPRAKSHQSQYPLGD
FT                   PVAEMASNVRGWRGMFNPDEAFHDLVRFARLWRPDLIVSDTFTFTGSLAARVTGAAHAR
FT                   ILFGADGLGQLRKACHEFWAHWRDDPAAPPTPADPLREWLEPILRGYGQEFDEDAVLGQ
FT                   WTLFPMPPWIHRPAGVSYIPLRHVPFNGPSTTPPWAYEPPTRRRVCITLGLAHREGGFG
FT                   HSASTRDLLDAVADLDIEVVATFTRDQLEPGQRIPDNVRVADFVPLNVLLPTCSALVHS
FT                   GGAGAFAAALEHGVPQLIVPTMYWSEKWWGPVAMANGLEERGAGVYVADADQLTAKELR
FT                   DHLVRVLDEAEFTENAARLRTEMIAMPSPNDIVPVLEKLTAEHWGTPR"
     MRILFVAAPF RSHLYVQTPL AWALRTAGHD VRIAASPDLA DDIAHSGLTG VTIGPLVSLS        60
     AHMAASAPAP DDAPAAPAPP ESATAAGPVP PRAKSHQSQY PLGDPVAEMA SNVRGWRGMF       120
     NPDEAFHDLV RFARLWRPDL IVSDTFTFTG SLAARVTGAA HARILFGADG LGQLRKACHE       180
     FWAHWRDDPA APPTPADPLR EWLEPILRGY GQEFDEDAVL GQWTLFPMPP WIHRPAGVSY       240
     IPLRHVPFNG PSTTPPWAYE PPTRRRVCIT LGLAHREGGF GHSASTRDLL DAVADLDIEV       300
     VATFTRDQLE PGQRIPDNVR VADFVPLNVL LPTCSALVHS GGAGAFAAAL EHGVPQLIVP       360
     TMYWSEKWWG PVAMANGLEE RGAGVYVADA DQLTAKELRD HLVRVLDEAE FTENAARLRT       420
     EMIAMPSPND IVPVLEKLTA EHWGTPR                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page