(data stored in ACNUC7421 zone)

EMBL: AP009493.PE618

AP009493.PE618       Location/Qualifiers
FT   CDS             complement(723442..724134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_618"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17447"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRM9"
FT                   /protein_id="BAG17447.1"
FT                   /translation="MTEAEKQQSLPRIVSPQEWLAARREFLVREKEFTRARDALNAQRR
FT                   ELPMVAVEKDYVFEGPDGDVGLLDLFEGRRQLIVHHVMFDPSWDEGCSSCRFQIRDLGH
FT                   LPHLHERGTSLALVSRAPYAKIQRYKERMGWSVPYFSSYGSHFNYDFHATLDESKQPLL
FT                   INFRTKEEHEEAVGPWDVWGHELPAVSVFLSEGDTIYHTYSSFSRGLDILLFTLNYLDL
FT                   TPLGRDGG"
     MTEAEKQQSL PRIVSPQEWL AARREFLVRE KEFTRARDAL NAQRRELPMV AVEKDYVFEG        60
     PDGDVGLLDL FEGRRQLIVH HVMFDPSWDE GCSSCRFQIR DLGHLPHLHE RGTSLALVSR       120
     APYAKIQRYK ERMGWSVPYF SSYGSHFNYD FHATLDESKQ PLLINFRTKE EHEEAVGPWD       180
     VWGHELPAVS VFLSEGDTIY HTYSSFSRGL DILLFTLNYL DLTPLGRDGG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page