(data stored in ACNUC7421 zone)

EMBL: AP009493.PE623

AP009493.PE623       Location/Qualifiers
FT   CDS             complement(728872..729594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_623"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17452"
FT                   /db_xref="GOA:B1VRN4"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRN4"
FT                   /protein_id="BAG17452.1"
FT                   /translation="MAQQTEPADITLPSPDRKDGPAPEQDPSRPGRAWWRRPWPLLLAL
FT                   LVTLFLVDELTAYLGLDPSEARITLNEDVPLHYPLLVAHIGFGTIALVTVVLQVWPLLR
FT                   RNHPRIHRASGRLYVFAGALPSAVLALAIMPLMPAWQGTIGVAVHALLWIGTTTMGYRA
FT                   ARKRQYDDHRRWMLYSFALATGVLWGRAMVNVMTYAELNIDVGYLFEVARWLGWMINLM
FT                   LVQWWLDRRPNRPAPAPV"
     MAQQTEPADI TLPSPDRKDG PAPEQDPSRP GRAWWRRPWP LLLALLVTLF LVDELTAYLG        60
     LDPSEARITL NEDVPLHYPL LVAHIGFGTI ALVTVVLQVW PLLRRNHPRI HRASGRLYVF       120
     AGALPSAVLA LAIMPLMPAW QGTIGVAVHA LLWIGTTTMG YRAARKRQYD DHRRWMLYSF       180
     ALATGVLWGR AMVNVMTYAE LNIDVGYLFE VARWLGWMIN LMLVQWWLDR RPNRPAPAPV       240
//

If you have problems or comments...

PBIL Back to PBIL home page