(data stored in ACNUC7421 zone)

EMBL: AP009493.PE624

AP009493.PE624       Location/Qualifiers
FT   CDS             729842..731227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_624"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17453"
FT                   /db_xref="GOA:B1VRN5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRN5"
FT                   /protein_id="BAG17453.1"
FT                   /translation="MSERIGDRAVVLGGSIAGLLAARALARHYTEVVVVDRDRLTGVRG
FT                   PRRGVPHGRHAHGLVARGHQILESLFPGLTEELVEAGIRPGDFSGDIRWYFNGRLLRPA
FT                   RTGLVSVPATRPVLEYHLRLRVQALTGITFLEEHDVLGLVTSSDRRRVTGVRVRPTAED
FT                   AEQRELAADLVVDTTGRGSRTPAWLDEFGYRRPEEEQVKIDLAYTTRHYRLSSDPFGSD
FT                   LAIIPAATPSHPRGAFFYRTPGEGHQVELSLTGVLGDHPPTDPEEFDRFTRSLPVPDIH
FT                   EAVRNAEALDAPVMHRFPASRRRHYERLDRFPERLLVMGDAVCSFNPVYAQGMTVAALQ
FT                   SLVLERHLRAGHAPEPLPFLRDISREIDSPWEFSAGADLGYAGVEAPRPARVRLANAYV
FT                   TRVQKAAVHDPALTNALMRVAGLMEPPQSLMRPATVLRVLRHAARRPPAPPGREVPAPE
FT                   KIA"
     MSERIGDRAV VLGGSIAGLL AARALARHYT EVVVVDRDRL TGVRGPRRGV PHGRHAHGLV        60
     ARGHQILESL FPGLTEELVE AGIRPGDFSG DIRWYFNGRL LRPARTGLVS VPATRPVLEY       120
     HLRLRVQALT GITFLEEHDV LGLVTSSDRR RVTGVRVRPT AEDAEQRELA ADLVVDTTGR       180
     GSRTPAWLDE FGYRRPEEEQ VKIDLAYTTR HYRLSSDPFG SDLAIIPAAT PSHPRGAFFY       240
     RTPGEGHQVE LSLTGVLGDH PPTDPEEFDR FTRSLPVPDI HEAVRNAEAL DAPVMHRFPA       300
     SRRRHYERLD RFPERLLVMG DAVCSFNPVY AQGMTVAALQ SLVLERHLRA GHAPEPLPFL       360
     RDISREIDSP WEFSAGADLG YAGVEAPRPA RVRLANAYVT RVQKAAVHDP ALTNALMRVA       420
     GLMEPPQSLM RPATVLRVLR HAARRPPAPP GREVPAPEKI A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page