(data stored in ACNUC7421 zone)

EMBL: AP009493.PE627

AP009493.PE627       Location/Qualifiers
FT   CDS             734354..735544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_627"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17456"
FT                   /db_xref="GOA:B1VRN8"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRN8"
FT                   /protein_id="BAG17456.1"
FT                   /translation="MDTTELAQAPNRADLVARATKLVPLLREKAPWAEENRELHEDTVR
FT                   AMAESGLLRTRLPARLGGYESDMRTQVEVLAELARGDGSASWTAGVWSISAWVAGLFPD
FT                   AVQDEVFTSPDDLVSGIISPTAMAVPAEGGIVVNGRWGFNSGAKHSKWNTNAAVLAMPD
FT                   GSHQPIMTLIPLASLEIVDDWHTAGLRGSGSVSTVAQDVFVPDARYIPLGGLIQGHSGH
FT                   GSNADALIHRAPIMPTACATVSATALGLAKGARDVFFERLPGRKITYTEYADQREAPLT
FT                   HLQVAEASVKIDETEFHVYRIADLVDAKNASGEPWTLEERARVRLDTGAACQRAKEAVD
FT                   VLNTASGASSIYTDVPIQRIERDVQTLNLHAIMHPNTNLELYGRILCGLAPNTQYL"
     MDTTELAQAP NRADLVARAT KLVPLLREKA PWAEENRELH EDTVRAMAES GLLRTRLPAR        60
     LGGYESDMRT QVEVLAELAR GDGSASWTAG VWSISAWVAG LFPDAVQDEV FTSPDDLVSG       120
     IISPTAMAVP AEGGIVVNGR WGFNSGAKHS KWNTNAAVLA MPDGSHQPIM TLIPLASLEI       180
     VDDWHTAGLR GSGSVSTVAQ DVFVPDARYI PLGGLIQGHS GHGSNADALI HRAPIMPTAC       240
     ATVSATALGL AKGARDVFFE RLPGRKITYT EYADQREAPL THLQVAEASV KIDETEFHVY       300
     RIADLVDAKN ASGEPWTLEE RARVRLDTGA ACQRAKEAVD VLNTASGASS IYTDVPIQRI       360
     ERDVQTLNLH AIMHPNTNLE LYGRILCGLA PNTQYL                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page