(data stored in ACNUC7421 zone)

EMBL: AP009493.PE63

AP009493.PE63        Location/Qualifiers
FT   CDS             complement(66749..67972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_63t"
FT                   /product="putative Dyp-type peroxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_63t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16892"
FT                   /db_xref="GOA:B1VLZ1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLZ1"
FT                   /protein_id="BAG16892.1"
FT                   /translation="MVMTEHEPTRAPYPGRRALVRGAAGLVGAGGLAATVTVSSASSIP
FT                   MSASTDGRVPFHGAHQAGILTRQQPFGGFVAFDVLARDRAELQALFTKLTARCRALTAG
FT                   VTPKNPEVAALRDPQDRLTITVGVGASLFDERYGLQGARPPGLVNMPLFPGDRLEPDRS
FT                   HGDLSVQICAQHPDAVLHVVRDLARETTGLLRTRWRADGFLNPPRPEGAPRSFIGFKDG
FT                   TAHPDTASKREMNRLVWVGHEGPAWARGGSYQVLRIIGIHAEKWDRVPVAKQEQIFGRR
FT                   KATGAPLDGRKESDLPDYGRDQEGRITPLDSHIRRANPRTPESENSILLRRSYNTDRGL
FT                   TPDGTLDVGLIFCCYQRDIARQFATVQKRLEGERFADFSVTTGGGYFLALPGVADGSDS
FT                   YASALLGQ"
     MVMTEHEPTR APYPGRRALV RGAAGLVGAG GLAATVTVSS ASSIPMSAST DGRVPFHGAH        60
     QAGILTRQQP FGGFVAFDVL ARDRAELQAL FTKLTARCRA LTAGVTPKNP EVAALRDPQD       120
     RLTITVGVGA SLFDERYGLQ GARPPGLVNM PLFPGDRLEP DRSHGDLSVQ ICAQHPDAVL       180
     HVVRDLARET TGLLRTRWRA DGFLNPPRPE GAPRSFIGFK DGTAHPDTAS KREMNRLVWV       240
     GHEGPAWARG GSYQVLRIIG IHAEKWDRVP VAKQEQIFGR RKATGAPLDG RKESDLPDYG       300
     RDQEGRITPL DSHIRRANPR TPESENSILL RRSYNTDRGL TPDGTLDVGL IFCCYQRDIA       360
     RQFATVQKRL EGERFADFSV TTGGGYFLAL PGVADGSDSY ASALLGQ                     407
//

If you have problems or comments...

PBIL Back to PBIL home page