(data stored in ACNUC7421 zone)

EMBL: AP009493.PE634

AP009493.PE634       Location/Qualifiers
FT   CDS             complement(743059..743703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_634"
FT                   /product="putative StrG-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_634"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17463"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRP5"
FT                   /protein_id="BAG17463.1"
FT                   /translation="MWRSGRPEVYTYDSAAFDFGAAVESIYKSDALDGLRPYRPMERLT
FT                   WKTDQSTDFHAAFYQQFDTKIRSLYRSFVKTLAPEVLGTDEYCFQRVPTFRIHFPGNVA
FT                   VGEFHTDGDYNHRDGEVNFWLPLTRAWGTNSVWVEQEKGANDYAPAELDVGQVLVFDAV
FT                   NWHHGNKVNETGSTRVSFDFRCIRLSDYSASGLRTVDAGRGLWIGEYFDVF"
     MWRSGRPEVY TYDSAAFDFG AAVESIYKSD ALDGLRPYRP MERLTWKTDQ STDFHAAFYQ        60
     QFDTKIRSLY RSFVKTLAPE VLGTDEYCFQ RVPTFRIHFP GNVAVGEFHT DGDYNHRDGE       120
     VNFWLPLTRA WGTNSVWVEQ EKGANDYAPA ELDVGQVLVF DAVNWHHGNK VNETGSTRVS       180
     FDFRCIRLSD YSASGLRTVD AGRGLWIGEY FDVF                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page