(data stored in ACNUC7421 zone)

EMBL: AP009493.PE635

AP009493.PE635       Location/Qualifiers
FT   CDS             744017..744991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_635"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17464"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030807"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRP6"
FT                   /protein_id="BAG17464.1"
FT                   /translation="MDDRYSPSPLWNYNNSVKVTEEGVAKLASFKSDPVNFKLALWDPQ
FT                   VNGVRYLKALIFELASRLTPENRGRLRRIRHRETGSPISVTHDGDSVCMDYLLAVHELE
FT                   FISRYVEPDGARVLEIGAGYGRTCHAILSNHRVEEYWIIDLGRALALSREYLRTVLDTE
FT                   AFSRVRFVSVDTTDDLDRALGTARFDLCLNVDSFAEMPPETVRNYLALIDRRCSALYVN
FT                   NPVGKYLEKELDNHAQGDEVVRMALATGLLRDLLDIHDSRAVAALAPKFLSSYRPGPRW
FT                   ETVGDGRAVPWSYYWQAVYRRPDEPPTAGRTTGRRTGQRGDAA"
     MDDRYSPSPL WNYNNSVKVT EEGVAKLASF KSDPVNFKLA LWDPQVNGVR YLKALIFELA        60
     SRLTPENRGR LRRIRHRETG SPISVTHDGD SVCMDYLLAV HELEFISRYV EPDGARVLEI       120
     GAGYGRTCHA ILSNHRVEEY WIIDLGRALA LSREYLRTVL DTEAFSRVRF VSVDTTDDLD       180
     RALGTARFDL CLNVDSFAEM PPETVRNYLA LIDRRCSALY VNNPVGKYLE KELDNHAQGD       240
     EVVRMALATG LLRDLLDIHD SRAVAALAPK FLSSYRPGPR WETVGDGRAV PWSYYWQAVY       300
     RRPDEPPTAG RTTGRRTGQR GDAA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page