(data stored in ACNUC7421 zone)

EMBL: AP009493.PE640

AP009493.PE640       Location/Qualifiers
FT   CDS             750494..750640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17469"
FT                   /db_xref="GOA:B1VRQ1"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ1"
FT                   /protein_id="BAG17469.1"
FT                   /translation="MIAALPAAQNLFTHTSHYGVAERFARDSILLSTLLSVPALIAVAA
FT                   LLG"
     MIAALPAAQN LFTHTSHYGV AERFARDSIL LSTLLSVPAL IAVAALLG                     48
//

If you have problems or comments...

PBIL Back to PBIL home page