(data stored in ACNUC7421 zone)

EMBL: AP009493.PE641

AP009493.PE641       Location/Qualifiers
FT   CDS             750846..751199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_641"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17470"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ2"
FT                   /protein_id="BAG17470.1"
FT                   /translation="MSENLWGYQPTAGHTVGTDLIGYKVEATDGSIGKVDKHSDDVTSS
FT                   YLVVDTGVWIFGKHVLLPAGTVSRVDNGDKKIYVDLTKEQIKDSPEFDKDKHVGDADFH
FT                   RTTGEYYGRHRRV"
     MSENLWGYQP TAGHTVGTDL IGYKVEATDG SIGKVDKHSD DVTSSYLVVD TGVWIFGKHV        60
     LLPAGTVSRV DNGDKKIYVD LTKEQIKDSP EFDKDKHVGD ADFHRTTGEY YGRHRRV          117
//

If you have problems or comments...

PBIL Back to PBIL home page