(data stored in ACNUC7421 zone)

EMBL: AP009493.PE643

AP009493.PE643       Location/Qualifiers
FT   CDS             751779..752369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_643"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17472"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ4"
FT                   /protein_id="BAG17472.1"
FT                   /translation="MHPDLIVIYTNRLNACQAFYTELGLTFVTEQHGPGPEHYATQLDG
FT                   TVFELYPASPRRPATGSLRLGLTIPVGPRTAPVGQHTHSDPDGRTVVLTVTQQTHPMTT
FT                   AQEARAAIHHAFGDTARTDIKTLPAGNLAITINKGNHAATIDGHDSSGWGWTVDPAEDD
FT                   GFTGHENIAATLDEALTSIRAALIRPGRADGAP"
     MHPDLIVIYT NRLNACQAFY TELGLTFVTE QHGPGPEHYA TQLDGTVFEL YPASPRRPAT        60
     GSLRLGLTIP VGPRTAPVGQ HTHSDPDGRT VVLTVTQQTH PMTTAQEARA AIHHAFGDTA       120
     RTDIKTLPAG NLAITINKGN HAATIDGHDS SGWGWTVDPA EDDGFTGHEN IAATLDEALT       180
     SIRAALIRPG RADGAP                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page