(data stored in ACNUC7421 zone)

EMBL: AP009493.PE644

AP009493.PE644       Location/Qualifiers
FT   CDS             752538..752891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_644"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17473"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ5"
FT                   /protein_id="BAG17473.1"
FT                   /translation="MGRRPHPVPMDPASWTALQHCLAHRQGQHTDTPHVIVTKITRTGR
FT                   APASTAHVSHLLDPCGVPPRTLRSTRLADLVNTLDPKLVAAALGMDPEGVMIYLADHVD
FT                   AGRLPIGTKFGAG"
     MGRRPHPVPM DPASWTALQH CLAHRQGQHT DTPHVIVTKI TRTGRAPAST AHVSHLLDPC        60
     GVPPRTLRST RLADLVNTLD PKLVAAALGM DPEGVMIYLA DHVDAGRLPI GTKFGAG          117
//

If you have problems or comments...

PBIL Back to PBIL home page