(data stored in ACNUC7421 zone)

EMBL: AP009493.PE648

AP009493.PE648       Location/Qualifiers
FT   CDS             complement(754341..755021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_648"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17477"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRQ9"
FT                   /protein_id="BAG17477.1"
FT                   /translation="MRTRRTAVAAVSVAAAAALSAPALASADGRDGHDMNHRGHKALTA
FT                   VGLTADQRLVEFTVDRPARTTDNGRVSGLRGDTKVVGIDFRVQDEKLYGVGDRGGVYTL
FT                   NTANARATKVSQLTVALAGKFGVDFNPAANRLRVISNTGQNLRHNIDDSAAPLGTTTDG
FT                   TLTNPITPPTTATGVTGAAYTNNDLNAATATTLFDIDTMADRVSLQSPANAGTLAPTGN
FT                   RLTS"
     MRTRRTAVAA VSVAAAAALS APALASADGR DGHDMNHRGH KALTAVGLTA DQRLVEFTVD        60
     RPARTTDNGR VSGLRGDTKV VGIDFRVQDE KLYGVGDRGG VYTLNTANAR ATKVSQLTVA       120
     LAGKFGVDFN PAANRLRVIS NTGQNLRHNI DDSAAPLGTT TDGTLTNPIT PPTTATGVTG       180
     AAYTNNDLNA ATATTLFDID TMADRVSLQS PANAGTLAPT GNRLTS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page