(data stored in ACNUC7421 zone)

EMBL: AP009493.PE649

AP009493.PE649       Location/Qualifiers
FT   CDS             755775..757376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_649"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17478"
FT                   /db_xref="InterPro:IPR025566"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR0"
FT                   /protein_id="BAG17478.1"
FT                   /translation="MKDSQSKPRSRRVLDRSLLVLGTTTLAAGLGAMTLAPGLSAASSH
FT                   REAPLIAGDPRADNTDVYAFTSPDKADTVTMVANWIPMEEPNGGPNFYAFGDDLRYNIK
FT                   IDNTGDGVADVTYSWRFRSSYRDDANQFLYNTGQVTSLNDPDLNFRQVYDLVVTTGGKS
FT                   RTVLRGVPAAPSRTGQASMPDYAALRKQATFGLPGGGKTYAGQAEDPFFADLRVFDLLY
FT                   GGDLSERGQDTLAGYNVNTIAIQVPKKQLALRGDSSRNPVIGVWSTTERAGVTVNDSRD
FT                   AKVNKQWKQVSRLGNPLVNEVVVPLKFKDAFNTLNPSQDRTVQPVVDKVYDPILPKLIQ
FT                   QVYGVPAPKTPRNDLAEIYLTGICKVCGPIKADLNAHRLNKDAVLRKIVPAEELRLNMA
FT                   VPPTAKPQRLGVLAGDLAGFPNGRRLADDVIDISLQAVEGAAQTGVLVPALADGDKVDT
FT                   NEVPFGTSFPYVALPHTKNVNRGPGATGRSAEQTATENTAASTAVQPTRAAALAGAGAL
FT                   LLGVGGFRLRRRRKES"
     MKDSQSKPRS RRVLDRSLLV LGTTTLAAGL GAMTLAPGLS AASSHREAPL IAGDPRADNT        60
     DVYAFTSPDK ADTVTMVANW IPMEEPNGGP NFYAFGDDLR YNIKIDNTGD GVADVTYSWR       120
     FRSSYRDDAN QFLYNTGQVT SLNDPDLNFR QVYDLVVTTG GKSRTVLRGV PAAPSRTGQA       180
     SMPDYAALRK QATFGLPGGG KTYAGQAEDP FFADLRVFDL LYGGDLSERG QDTLAGYNVN       240
     TIAIQVPKKQ LALRGDSSRN PVIGVWSTTE RAGVTVNDSR DAKVNKQWKQ VSRLGNPLVN       300
     EVVVPLKFKD AFNTLNPSQD RTVQPVVDKV YDPILPKLIQ QVYGVPAPKT PRNDLAEIYL       360
     TGICKVCGPI KADLNAHRLN KDAVLRKIVP AEELRLNMAV PPTAKPQRLG VLAGDLAGFP       420
     NGRRLADDVI DISLQAVEGA AQTGVLVPAL ADGDKVDTNE VPFGTSFPYV ALPHTKNVNR       480
     GPGATGRSAE QTATENTAAS TAVQPTRAAA LAGAGALLLG VGGFRLRRRR KES              533
//

If you have problems or comments...

PBIL Back to PBIL home page