(data stored in ACNUC7421 zone)

EMBL: AP009493.PE65

AP009493.PE65        Location/Qualifiers
FT   CDS             complement(68576..69214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_65t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_65t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16894"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLZ3"
FT                   /protein_id="BAG16894.1"
FT                   /translation="MLFLTGCGTQSGAPRGEAASDSGGRTIRAQKVMQLTQVHGETGMT
FT                   LLEGPVFAEDGGLFVVDVTAPEGKPKVIRVDVERKTSRAVHTDGTGAYTSAQFSPYDGR
FT                   LYLSDFAHGEIVSLAPGGGDVRTFFSGEVGGARMNPDDIAFDREGNLYISDSRGLSVHL
FT                   VRVGCAGRAVALRRGTEAGSHLLGRRGLPRGPPKMFPSVECIRPYGSTN"
     MLFLTGCGTQ SGAPRGEAAS DSGGRTIRAQ KVMQLTQVHG ETGMTLLEGP VFAEDGGLFV        60
     VDVTAPEGKP KVIRVDVERK TSRAVHTDGT GAYTSAQFSP YDGRLYLSDF AHGEIVSLAP       120
     GGGDVRTFFS GEVGGARMNP DDIAFDREGN LYISDSRGLS VHLVRVGCAG RAVALRRGTE       180
     AGSHLLGRRG LPRGPPKMFP SVECIRPYGS TN                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page