(data stored in ACNUC7421 zone)

EMBL: AP009493.PE650

AP009493.PE650       Location/Qualifiers
FT   CDS             757475..758824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17479"
FT                   /db_xref="GOA:B1VRR1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR1"
FT                   /protein_id="BAG17479.1"
FT                   /translation="MHPDHNTPTSTPPPAPSRGSRRLWNIVITMALGATMFAAGAVMLT
FT                   PGANTAPRTGHGRTDEAPRGSIEALQARVARLPKDPGGWAALGMAYVQQARSTADPATY
FT                   DRAEKALRTSLSVQGEGNTDAETAMGALAAARHDFPTALRWARKATTSGPYSSSAYGVL
FT                   ADAHTQLGHYDEADEAVQKMTDLRPDAASLARASYAFELKGNTTRARALMQRSLAAAAT
FT                   PADKAFAHSVLAGLDLQDANPREALARTQNALRTAPTDSALLETRARAYLALGDTTKAV
FT                   ADYKAAIAIAPLPHYLLGLGELEQALGHRERAAENYDLLRAQDRIREAAGDPADTDAIL
FT                   FEADHGNPRRAVALAEGTLRNRPFVAVHDAYAWALHRAGRDTEALVQADKSLAQGTRSA
FT                   IFRYHRAAIHHALGDPAAARRDLTEALREPGFHPLHARAARDLLQRIDTP"
     MHPDHNTPTS TPPPAPSRGS RRLWNIVITM ALGATMFAAG AVMLTPGANT APRTGHGRTD        60
     EAPRGSIEAL QARVARLPKD PGGWAALGMA YVQQARSTAD PATYDRAEKA LRTSLSVQGE       120
     GNTDAETAMG ALAAARHDFP TALRWARKAT TSGPYSSSAY GVLADAHTQL GHYDEADEAV       180
     QKMTDLRPDA ASLARASYAF ELKGNTTRAR ALMQRSLAAA ATPADKAFAH SVLAGLDLQD       240
     ANPREALART QNALRTAPTD SALLETRARA YLALGDTTKA VADYKAAIAI APLPHYLLGL       300
     GELEQALGHR ERAAENYDLL RAQDRIREAA GDPADTDAIL FEADHGNPRR AVALAEGTLR       360
     NRPFVAVHDA YAWALHRAGR DTEALVQADK SLAQGTRSAI FRYHRAAIHH ALGDPAAARR       420
     DLTEALREPG FHPLHARAAR DLLQRIDTP                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page