(data stored in ACNUC7421 zone)

EMBL: AP009493.PE651

AP009493.PE651       Location/Qualifiers
FT   CDS             758821..760491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_651"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17480"
FT                   /db_xref="GOA:B1VRR2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR2"
FT                   /protein_id="BAG17480.1"
FT                   /translation="MNNTLRRTLTTLAAGALVAVANVASAPAATAHPLGNFSVNYHTGL
FT                   VLRTDRIDAHVVVDHAEISALQERSAIDTDHDGKVSDDESRVHAEKTCSDLSGQLHLSV
FT                   GGTQAEWRRSSATLVYENGEAGLRTSRLTCSLTSPADLTERAGIRAETDYDTRRVGWHE
FT                   MTATGQGVRITRTDVPATSTTRELRQYPADPLASPLDQRSATLRSEPGQGHAAVPAVVA
FT                   DLPGAGVIGGVLAKVTGAFDSLVGAREITLPVGLLALFLALVLGASHAAMPGHGKTIMA
FT                   AYLAGRRGTRRDALTVGATVTLTHTAGVLVLGLALPVSTHLAGETVLMWLGAASGLLVT
FT                   GIGLWLLTGAVRGTPQHNHHHHGPGHSHSHSHSHSHSHDDHGHHHDHDHGDDSPHHHGP
FT                   VSPASARDSTPAGGLRATPAVATLTPPDHEHHPANTSTAPRDAQRTSRTGLIGMGIAGG
FT                   LVPSPSALVVLLGAVALGRTAFGVLLVIGYGFGMAATLTLAGLLLVRLRERIESHDRAR
FT                   TFRHNPVLRKLARTGPVITSVLVIAVGLGLMLRAAAGTG"
     MNNTLRRTLT TLAAGALVAV ANVASAPAAT AHPLGNFSVN YHTGLVLRTD RIDAHVVVDH        60
     AEISALQERS AIDTDHDGKV SDDESRVHAE KTCSDLSGQL HLSVGGTQAE WRRSSATLVY       120
     ENGEAGLRTS RLTCSLTSPA DLTERAGIRA ETDYDTRRVG WHEMTATGQG VRITRTDVPA       180
     TSTTRELRQY PADPLASPLD QRSATLRSEP GQGHAAVPAV VADLPGAGVI GGVLAKVTGA       240
     FDSLVGAREI TLPVGLLALF LALVLGASHA AMPGHGKTIM AAYLAGRRGT RRDALTVGAT       300
     VTLTHTAGVL VLGLALPVST HLAGETVLMW LGAASGLLVT GIGLWLLTGA VRGTPQHNHH       360
     HHGPGHSHSH SHSHSHSHDD HGHHHDHDHG DDSPHHHGPV SPASARDSTP AGGLRATPAV       420
     ATLTPPDHEH HPANTSTAPR DAQRTSRTGL IGMGIAGGLV PSPSALVVLL GAVALGRTAF       480
     GVLLVIGYGF GMAATLTLAG LLLVRLRERI ESHDRARTFR HNPVLRKLAR TGPVITSVLV       540
     IAVGLGLMLR AAAGTG                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page