(data stored in ACNUC7421 zone)

EMBL: AP009493.PE652

AP009493.PE652       Location/Qualifiers
FT   CDS             761077..761724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_652"
FT                   /product="conserved hypothetical protein containing a
FT                   fasciclin domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_652"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17481"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR3"
FT                   /protein_id="BAG17481.1"
FT                   /translation="MTAFRYRRAALALTAATVLPLALSACGGGGSSDTADKAASSAPAE
FT                   EKSSAPAEGTPADGPFGPACASVPKDGAGSFDGMAQDPVATAASNNPDLSTLVTAVKKA
FT                   GLVDTLNNAQNITVFAPTNDAFAKIPKADLDKVLADKEMLTSILTYHVVGEKLSPMQLE
FT                   SGTYDTLQKSPLTTKGSGENYTVNDTSKVVCGNVPTANATVHIVDTVLMPKS"
     MTAFRYRRAA LALTAATVLP LALSACGGGG SSDTADKAAS SAPAEEKSSA PAEGTPADGP        60
     FGPACASVPK DGAGSFDGMA QDPVATAASN NPDLSTLVTA VKKAGLVDTL NNAQNITVFA       120
     PTNDAFAKIP KADLDKVLAD KEMLTSILTY HVVGEKLSPM QLESGTYDTL QKSPLTTKGS       180
     GENYTVNDTS KVVCGNVPTA NATVHIVDTV LMPKS                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page